Protein coding transcript 72363

• Transcript: Ll_transcript_353046
• CDS coordinates: 103-816 (+)
• Peptide sequence: MIFRSRNKEYLPIVGVADFNKLSARLIFGADSPAIQENRVTTVQCLSGTGSLRVGGEFLARHYHQRTIYIPQPTWGNHPKIFTLAGLSVKTYRYYAPRTKGLDFQGLLEDLGSAPSGSVVLLHACAHNPTGVDPTPEQWEHIRQLIRSKALLPFFDSAYQGFASGSLDTDAQPVRTFVADGGELLVAQSYAKNMGLYGERVGALSIVCKSADVASRVESQVKLVVRPMYSNPPIHGAS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_353046

• Blastp: Aspartate aminotransferase 1 from Medicago with 89.74% of identity
• Blastx: Aspartate aminotransferase, cytoplasmic from Oryza sativa with 88.46% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438405.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;