Transcript | Ll_transcript_354679 |
---|---|
CDS coordinates | 2255-3253 (+) |
Peptide sequence | MSNCFIKGRYIMDGVVIANEIIDQARKKKDGDCFIFKVDFEKAFDSVNWSFILYMLERMEFCLKWRNWIKNCLHSNSVSILVNGSPAKEFSMARGLRQGDPIAPFLFLIAAEGLAGIMRSAVSKKIFRGYLVGQNEIEISHLLYVDDTLLIGQDSVANIYILKSILKCFELTSGLRINFHKSSFIGINSGVGFVQMAVDKLICKVGSVPFKFLGIPVGANPRRISTWSTVVNSFKKRLSSWQHKLISFGGRVTLIKSVLNSLFVFLFSFFKAPVSVIHELEKIQRRFLWGRGEERKCIHCVSWNTVCRSRGDVGLGIKNLSLFNLSLLGKWR* |
ORF Type | complete |
Blastp | LINE-1 retrotransposable element ORF2 protein from Homo with 25.09% of identity |
---|---|
Blastx | LINE-1 reverse transcriptase homolog from Nycticebus with 26.43% of identity |
Eggnog | NA(ENOG410Y9TZ) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019465331.1) |
Pfam | Reverse transcriptase (RNA-dependent DNA polymerase) (PF00078.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer