Protein coding transcript 72450

• Transcript: Ll_transcript_354691
• CDS coordinates: 1126-1566 (+)
• Peptide sequence: MLAVPGILVPEALGLGNWVQAQEWAAVPGGQATYLGNPVPWGTLPTILAIEFLSIAFVEHQRSIEKDPEKKKYPGGAFDPLGYSKDPKKFAENKVKEVKNGRLALLAFVGFIVQQSAYPGTGPLENLATHLADPWHNNIGNILIPK*
• ORF Type: complete

Annotations of Ll_transcript_354691

• Blastp: Chlorophyll a-b binding protein 6, chloroplastic from Arabidopsis with 91.72% of identity
• Blastx: Chlorophyll a-b binding protein 6, chloroplastic from Arabidopsis with 92.17% of identity
• Eggnog: Chlorophyll A-B binding protein(ENOG410XVD6)
• Kegg: Link to kegg annotations (AT3G54890)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460940.1)
• Pfam: Chlorophyll A-B binding protein (PF00504.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;