Protein coding transcript 72454

• Transcript: Ll_transcript_354688
• CDS coordinates: 3-419 (+)
• Peptide sequence: PEALGLGDWVEAQEWAAVPDGQATYLGNPVPWGTLPVIIAIEFMAIAFAEIQRVVEKDTEKKKYPGGYFDPLGYSQDVEKFEEYKVKEIKNGRLALLACVGFAVQQAAYPGTGPLDNLATHLADPWHNNIGNVLIPSL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_354688

• Blastp: Chlorophyll a-b binding protein 1B-21, chloroplastic from Hordeum with 80.88% of identity
• Blastx: Chlorophyll a-b binding protein 1B-21, chloroplastic from Hordeum with 81.2% of identity
• Eggnog: Chlorophyll A-B binding protein(ENOG410XVD6)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413590.1)
• Pfam: Chlorophyll A-B binding protein (PF00504.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;