Protein coding transcript 72465

• Transcript: Ll_transcript_353072
• CDS coordinates: 328-1191 (+)
• Peptide sequence: MQALVRVQAHVRANNVRKSPEEKAAQKLLDEHHNQADSVTEAEQRWCEIPGTVDDVKAKLRMRQEGAIKRDRAMTYSLSTQQSRMCASPNSRSSKAVTPLKHHSLDNKSLGCTLLERWMATKPWESPMSRRNEDLVPTFQSRMNGVTKRISVKSHTQSTPSSSAISSECMYDDSPVSTSCTSGSPPSLRSTNMVEATEEKHVHKLSYMNLTESTKAKLKGCRSSSQNSKRIAKEDCMSNSSKTTSTFLNVDARSSSGSDPSVNLWKDLSATPLRTSYQKRYARREFP*
• ORF Type: complete

Annotations of Ll_transcript_353072

• Blastp: Protein IQ-DOMAIN 1 from Arabidopsis with 32.28% of identity
• Blastx: Protein IQ-DOMAIN 1 from Arabidopsis with 34.03% of identity
• Eggnog: NA(ENOG411040N)
• Kegg: Link to kegg annotations (AT3G09710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448230.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;