Protein coding transcript 72505

• Transcript: Ll_transcript_355375
• CDS coordinates: 228-611 (+)
• Peptide sequence: MTKDVEVQEHQGGGEYSAKDYQDPPPAPLFDLDELRKWSLYRAVIAEFIATLLFLYITILTIIGYNSQTDKNKGGTECDGVGLLGIAWAFGGMIFILVYCTAGISGNPFHSCYMHLWLLYFHLKTMI*
• ORF Type: complete

Annotations of Ll_transcript_355375

• Blastp: Aquaporin PIP2-7 from Zea with 80.37% of identity
• Blastx: Aquaporin PIP2-7 from Zea with 82.78% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000345)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453971.1)
• Pfam: Major intrinsic protein (PF00230.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;