Protein coding transcript 72524

• Transcript: Ll_transcript_354129
• CDS coordinates: 1989-2747 (+)
• Peptide sequence: MISLYFCSRYSTNNKLPDGGQIIIGGRRQFNYEFYPKTEATAKNTYSLPFLVQTNEPRIENNLYPFVFLNVDGNLFIFANNRAILFNYTNNVVVKTFPQIPGGDPRSYPSSGSAVLLPLRNLHGAVLEAEVLVCGGAPKGSFEQASKGHFIGALNTCARVKVTDPNPNWVMETMPDGRVMSDMVMLPDGNVLIVNGAGSGTAGWRFGRNPALNPIIYKTYSPLGSRFELQNPSSIPRMYHSTAVLVRDGRVS*
• ORF Type: complete

Annotations of Ll_transcript_354129

• Blastp: Aldehyde oxidase GLOX1 from Arabidopsis with 48.98% of identity
• Blastx: Aldehyde oxidase GLOX1 from Arabidopsis with 48.98% of identity
• Eggnog: Glyoxal oxidase(ENOG41110V0)
• Kegg: Link to kegg annotations (AT1G67290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457541.1)
• Pfam: Glyoxal oxidase N-terminus (PF07250.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;