Transcript | Ll_transcript_354115 |
---|---|
CDS coordinates | 1180-1662 (+) |
Peptide sequence | MIDGLWPDYNNGTWPACCTKSSFDPNAISTLTDALEQYWPSLSCSKPSSCHGGKGSFWGHEWEKHGTCSSPVVSNEYDYFRTTLNVYFKYNVTKVLNEAGYVPSNSEKYPIGGIISAIENAFHASPQIVCSRGAVEELRLCFYKDFTVGNLPLLCNIFSI* |
ORF Type | complete |
Blastp | Ribonuclease 2 from Arabidopsis with 70.34% of identity |
---|---|
Blastx | Ribonuclease 2 from Arabidopsis with 70.07% of identity |
Eggnog | ribonuclease T2 activity(ENOG4111M7G) |
Kegg | Link to kegg annotations (AT2G39780) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460218.1) |
Pfam | Ribonuclease T2 family (PF00445.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer