Transcript | Ll_transcript_354117 |
---|---|
CDS coordinates | 234-1436 (+) |
Peptide sequence | MASSLLLLPILLTALTLPLPLLVSADNGKWQLLQKSIGIVAMHMQLLHNDRVVIYDRTDFGFSNLSLPNGRCRHDDKELAVKTDCTAHSVEYDVASNRFRALFIQTNVWCSSGSVSPNGTLVQTGGFNDGERKVRTYSPCPTCDWQELENGLVARRWYSTNNKLPDGGQIIIGGRRQFNYEFYPKTEATAKNTYSLPFLVQTNEPRIENNLYPFVFLNVDGNLFIFANNRAILFNYTNNVVVKTFPQIPGGDPRSYPSSGSAVLLPLRNLHGAVLEAEVLVCGGAPKGSFEQASKGHFIGALNTCARVKVTDPNPNWVMETMPDGRVMSDMVMLPDGNVLIVNGAGSGTAGWRFGRNPALNPIIYKTYSPLGSRFELQNPSSIPRMYHSTAVLVRDGRVS* |
ORF Type | complete |
Blastp | Aldehyde oxidase GLOX from Vitis with 46.28% of identity |
---|---|
Blastx | Aldehyde oxidase GLOX from Vitis with 46.28% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458830.1) |
Pfam | Glyoxal oxidase N-terminus (PF07250.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer