Protein coding transcript 72538

• Transcript: Ll_transcript_354121
• CDS coordinates: 1180-1518 (+)
• Peptide sequence: MIDGLWPDYNNGTWPACCTKSSFDPNAISTLTDALEQYWPSLSCSKPSSCHGGKGSFWGHEWEKHGTCSSPVVSNEYDYFRTTLNVYFKYNVTVCSQIIDFFLYPDVSLLFL*
• ORF Type: complete

Annotations of Ll_transcript_354121

• Blastp: Ribonuclease 2 from Arabidopsis with 72.83% of identity
• Blastx: Ribonuclease 2 from Arabidopsis with 72.34% of identity
• Eggnog: ribonuclease T2 activity(ENOG4111M7G)
• Kegg: Link to kegg annotations (AT2G39780)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460218.1)
• Pfam: Ribonuclease T2 family (PF00445.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;