Protein coding transcript 7263

• Transcript: Ll_transcript_395506
• CDS coordinates: 129-1472 (+)
• Peptide sequence: MASVHANVASIVCKNGNNGCQSKFPSTAFLPGFDVVGRVSSAWKKELTPSYMALGPKATLTFDPLATNSDKTKQKKSTVDPASPDFLPLPSFEQCFPKSTKEHREVIHEETGHSLKVPFRRVHLSGDEPQFDTYDTSGPQNINPRVGLPKLRKDWIDRREKIGAPRFTQMYYAKQGIITEEMLYCATREKLSPEFVRSEVARGRAIIPSNKNHLELEPMIVGRNFLVKVNANIGNSAVASSIEEEVYKVQWATMWGADTVMDLSTGRHIHETREWILRNSSVPVGTVPIYQALEKVNGIAENLTWEVFRDTLIEQAEQGVDYFTIHAGVLLRYIPLTAKRMTGIVSRGGSIHAKWCLAYHKENFAYEHWDDILDICNQYDVALSIGDGLRPGSIYDANDTAQFAELLTQGELTRRAWEKDVQVINSSNFFYNTVLINLWQDCSMVIT*
• ORF Type: complete

Annotations of Ll_transcript_395506

• Blastp: Phosphomethylpyrimidine synthase, chloroplastic from Arabidopsis with 82.82% of identity
• Blastx: Phosphomethylpyrimidine synthase, chloroplastic from Arabidopsis with 82.82% of identity
• Eggnog: thiamine diphosphate biosynthetic process(COG0422)
• Kegg: Link to kegg annotations (AT2G29630)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455701.1)
• Pfam: ThiC-associated domain (PF13667.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;