Protein coding transcript 72668

• Transcript: Ll_transcript_355146
• CDS coordinates: 357-752 (+)
• Peptide sequence: MGCDHHVCAKRFSFISISLFFLIISSWTLQGFVTEEGTRTTPKQNGFQKIVHDDKVVVRARIGSRPPKCEKRCRSCGPCEAIQVPTNPQAHNEKINVNPSTVSVTAYEKGGNVNYKPMSWKCKCGNLIFNP*
• ORF Type: complete

Annotations of Ll_transcript_355146

• Blastp: EPIDERMAL PATTERNING FACTOR-like protein 2 from Arabidopsis with 49% of identity
• Blastx: EPIDERMAL PATTERNING FACTOR-like protein 2 from Arabidopsis with 52.94% of identity
• Eggnog: epidermal patterning factor-like protein(ENOG410YZE3)
• Kegg: Link to kegg annotations (AT4G37810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444956.1)
• Pfam: Epidermal patterning factor proteins (PF17181.3)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;