Protein coding transcript 72734

• Transcript: Ll_transcript_352954
• CDS coordinates: 358-675 (+)
• Peptide sequence: MCQDELLWGAAWLHKATKNQMYLNYIKVNGQTLGSAEFDNTFGWDNKHVGARILLSKAFLVQKVNTLHDYKGHADNFICSVIPDASFSSTQYTPGGLLFKMNDSNM
• ORF Type: 3prime_partial

Annotations of Ll_transcript_352954

• Blastp: Endoglucanase 17 from Arabidopsis with 84.62% of identity
• Blastx: Endoglucanase 17 from Arabidopsis with 66.67% of identity
• Eggnog: hydrolase family(ENOG410XPC9)
• Kegg: Link to kegg annotations (AT4G02290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420020.1)
• Pfam: Glycosyl hydrolase family 9 (PF00759.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;