Protein coding transcript 72755

• Transcript: Ll_transcript_353653
• CDS coordinates: 2569-3165 (+)
• Peptide sequence: MLAAEATFGALHGSLGMDTYWDALRNSWIWQELYKARNYRPAFEYGLIPGLALSGLEHYIFRGRYPITLKHGKPDHEATNAAQLHSPIDYPKADGVLSFDVPTSLHRSNTNHDHDQPPHLRLRDPKIPELTNLPVYAAPETRYCPARVYEYVGEQSQLKLQINAQNCLHCKACDIKDPKQNIEWTVPEGGGGPGYSVM*
• ORF Type: complete

Annotations of Ll_transcript_353653

• Blastp: Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial from Arabidopsis with 77.39% of identity
• Blastx: Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial from Arabidopsis with 77.5% of identity
• Eggnog: geranylgeranyl reductase(COG0644)
• Kegg: Link to kegg annotations (AT2G43400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457832.1)
• Pfam: Electron transfer flavoprotein-ubiquinone oxidoreductase, 4Fe-4S (PF05187.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;