Protein coding transcript 72766

• Transcript: Ll_transcript_353672
• CDS coordinates: 1160-1471 (+)
• Peptide sequence: MKIFTYAYIPCQNNEWYSSNKEGMRSASRGGFVTRLGLFAANEDPISAILLCAVGPSVSMYLYKCCIQFTKEIDKIESNLKRLNIQILLRDFALPYYFLLYCR*
• ORF Type: complete

Annotations of Ll_transcript_353672

• Blastp: Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 42.48% of identity
• Blastx: Transposon Tf2-11 polyprotein from Schizosaccharomyces with 29.23% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YIL082W-A)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450597.1)
• Pfam: Integrase core domain (PF00665.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;