Protein coding transcript 72785

• Transcript: Ll_transcript_353823
• CDS coordinates: 1225-1539 (+)
• Peptide sequence: MCLSFQIRRKMREIIINHATSVDLKELVKKFIPESIGKEIEKATCGIYPLQNVYIRKVKILKAPKFDLGKLMEVHGDYSEDVGTKVDRPADETVAEPAQEIVGA*
• ORF Type: complete

Annotations of Ll_transcript_353823

• Blastp: 40S ribosomal protein S3a-1 from Vitis with 84.85% of identity
• Blastx: 40S ribosomal protein S3a from Cicer with 92.73% of identity
• Eggnog: Ribosomal protein(COG1890)
• Kegg: Link to kegg annotations (100249434)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423800.1)
• Pfam: Ribosomal S3Ae family (PF01015.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;