Protein coding transcript 72791

• Transcript: Ll_transcript_353818
• CDS coordinates: 80-865 (+)
• Peptide sequence: MAVGKNKRISKGKKGGKKKAADPFAKKDWYDIKAPSLFQVKNVGKTLVSRTQGTKIASEGLKHRVFEVSLADLQGDEDHAFRKIRLRAEDVQGKNVLTNFWGMDFTTDKLRSLVRKWQTLIEAHVDVKTTDNYTLRLFCIGFTKRRANQIKRTSYAQSSQIRQIRRKMREIIINHATSVDLKELVKKFIPESIGKEIEKATSGIYPLQNVYIRKVKILKAPKFDLGKLMEVHGDYSEDVGTKVDRPVDETTAEPAPEIVGA*
• ORF Type: complete

Annotations of Ll_transcript_353818

• Blastp: 40S ribosomal protein S3a from Cicer with 90.42% of identity
• Blastx: 40S ribosomal protein S3a from Cicer with 89.74% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101513556)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423800.1)
• Pfam: Ribosomal S3Ae family (PF01015.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;