Transcript | Ll_transcript_354541 |
---|---|
CDS coordinates | 90-440 (+) |
Peptide sequence | MEEKTLSSFDFDFDDENNSKTFDNYSDAKSNTIVKFSDPMNCELFVDDIYPYLCIMELRPRFTSSSHNNNNNSNSSKLPSVTVVPGVPMLGNMLQLKEEPYKTFTNMAMDSFIQSE* |
ORF Type | complete |
Blastp | Ent-kaurene oxidase, chloroplastic from Arabidopsis with 60.98% of identity |
---|---|
Blastx | Ent-kaurene oxidase, chloroplastic from Arabidopsis with 61.54% of identity |
Eggnog | Cytochrome p450(COG2124) |
Kegg | Link to kegg annotations (AT5G25900) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447634.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer