Protein coding transcript 72830

• Transcript: Ll_transcript_354541
• CDS coordinates: 90-440 (+)
• Peptide sequence: MEEKTLSSFDFDFDDENNSKTFDNYSDAKSNTIVKFSDPMNCELFVDDIYPYLCIMELRPRFTSSSHNNNNNSNSSKLPSVTVVPGVPMLGNMLQLKEEPYKTFTNMAMDSFIQSE*
• ORF Type: complete

Annotations of Ll_transcript_354541

• Blastp: Ent-kaurene oxidase, chloroplastic from Arabidopsis with 60.98% of identity
• Blastx: Ent-kaurene oxidase, chloroplastic from Arabidopsis with 61.54% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT5G25900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447634.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;