Transcript | Ll_transcript_353730 |
---|---|
CDS coordinates | 101-856 (+) |
Peptide sequence | MYFIQEKESLITELRKELRLSNEEHRELLGRVNADDVIKRIREWRQAVGHQPGMLSTGQALHDSNPSPTVSASRKKQKITPSVPSRSFGGPSPFPPQTVTTPHQPSSSTGKRGSVPGSKGKKQKPGQIAPSVSSMKQYPSSGPGGRNQVTNRAEGVSFDSLIGRRVRTKWPDDNNFYEAVITDYNPADVSTFPNYIGILFSLLCSGMFTFLLPNFQDRHNLVYDMGSTEETWEWVNLSEIQYFNFRYLLKIF |
ORF Type | 3prime_partial |
Blastp | Protein EMSY-LIKE 4 from Arabidopsis with 48.45% of identity |
---|---|
Blastx | Protein EMSY-LIKE 4 from Arabidopsis with 44.75% of identity |
Eggnog | Chromosome 11 open reading frame 30(ENOG410YF3T) |
Kegg | Link to kegg annotations (AT2G44440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449564.1) |
Pfam | ENT domain (PF03735.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer