| Transcript | Ll_transcript_301216 |
|---|---|
| CDS coordinates | 2-310 (+) |
| Peptide sequence | TSFLSKVQIPSPLFPLLHKLTMHVTHSMKAELKGTSISLQNSTTLSNTTPQNPLSGALKGCLGSLDGACIEKLLFHCASALESNDITLAQQVMWVLNNYASPL |
| ORF Type | internal |
| Blastp | Scarecrow-like protein 32 from Arabidopsis with 48% of identity |
|---|---|
| Blastx | Scarecrow-like protein 32 from Arabidopsis with 51.11% of identity |
| Eggnog | Scarecrow-like protein(ENOG410XRRT) |
| Kegg | Link to kegg annotations (AT3G49950) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019447790.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer