Protein coding transcript 72926

• Transcript: Ll_transcript_354779
• CDS coordinates: 1-303 (+)
• Peptide sequence: LLSIIIFSVLSETDTRIEESMAFAGTTQKCMACDKTVYLVDKLTADNRVYHKACFKCHHCRGTLKLGNYNSFEGVLYCRPHYDQTIKRTGSLDKSFEGNI*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_354779

• Blastp: LIM domain-containing protein WLIM1 from Arabidopsis with 91.03% of identity
• Blastx: LIM domain-containing protein WLIM1 from Arabidopsis with 77.32% of identity
• Eggnog: Microtubule associated monoxygenase, calponin and LIM domain containing(COG5069)
• Kegg: Link to kegg annotations (AT1G10200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436961.1)
• Pfam: LIM domain (PF00412.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;