Protein coding transcript 72946

• Transcript: Ll_transcript_355208
• CDS coordinates: 297-662 (+)
• Peptide sequence: MSDLASARALAYDMVYNGVEIGGGSLRIYKRDIQQKVLEIVGISIEQAEAKFGYLLEALDMGAPPHGGIAYGLDRLVMMLVGANSIRDVIAFPKTTTAQCALTRSPSEVDPQQLKDLSITI*
• ORF Type: complete

Annotations of Ll_transcript_355208

• Blastp: Aspartate--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 88.24% of identity
• Blastx: Aspartate--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 77.71% of identity
• Eggnog: aspartyl-trna synthetase(COG0173)
• Kegg: Link to kegg annotations (AT4G33760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020220489.1)
• Pfam: tRNA synthetases class II (D, K and N) (PF00152.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;