Transcript | Ll_transcript_355210 |
---|---|
CDS coordinates | 1838-3040 (+) |
Peptide sequence | MKTGTFYALPQSPQLFKQMLMVAGFDKYYQVARCFRDEDLRADRQPEFTQLDMELAFTPLEDMLTLNEELIRKVFLDIKGVELPNPFPRLTYAEAMARYGSDRPDTRFDLELKDVSDIFSGSSFRVLSDSLESGGVIKVLSIPSGAKRYSNSALKKGDIYSEALKSGARGLPFIKVLDNGEIEGISALVSSMDSTTRENLLQRCSAGPGDLILFAVGPHASVNKTLDRLRTRVAHDLDLIDHGKHSILWITDFPMFEWNDSEQRFEALHHPFTAPNPEDMSDLASARALAYDMVYNGVEIGGGSLRIYKRDIQQKVLEIVGISIEQAEAKFGYLLEALDMGAPPHGGIAYGLDRLVMMLVGANSIRDVIAFPKTTTAQCALTRSPSEVDPQQLKDLSITI* |
ORF Type | complete |
Blastp | Aspartate--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 81.91% of identity |
---|---|
Blastx | Aspartate--tRNA ligase, chloroplastic/mitochondrial from Arabidopsis with 81.91% of identity |
Eggnog | aspartyl-trna synthetase(COG0173) |
Kegg | Link to kegg annotations (AT4G33760) |
CantataDB | Link to cantataDB annotations (CNT0000141) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020220208.1) |
Pfam | tRNA synthetases class II (D, K and N) (PF00152.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer