Protein coding transcript 7298

• Transcript: Ll_transcript_395466
• CDS coordinates: 1197-1856 (+)
• Peptide sequence: MFYTFIRLAPEHPIPAAYEDSWAALQWVASHKNNTGPEAWLNEHADFERVFLGGESSGANIVHNIAMVAGHPDLELGIEILGACLVHPYFWGSEPIGSEALTPDQNRKAMLDKLWPFVCPSMPDNDDPRVNPVAEGAPSLARLCCKRMLVCVAEKDVLRDRGWLYYNALGRSGWPGVVQIEETLGEGHAFHLYNLGCNKAQDFIKRLAEFYNRDMPPEV*
• ORF Type: complete

Annotations of Ll_transcript_395466

• Blastp: 2-hydroxyisoflavanone dehydratase from Soja with 49.76% of identity
• Blastx: 2-hydroxyisoflavanone dehydratase from Soja with 49.76% of identity
• Eggnog: alpha beta hydrolase fold-3 domain protein(COG0657)
• Kegg: Link to kegg annotations (547489)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457465.1)
• Pfam: alpha/beta hydrolase fold (PF07859.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;