Protein coding transcript 73009

• Transcript: Ll_transcript_353132
• CDS coordinates: 126-902 (+)
• Peptide sequence: MATRDRDRELLVPVADSAGDGSATFSKSSSSSSLSHHSGNETFIKVVRSWASKKFMTGCVILFPIAITFYITWWFIHFVDGFFSPIYAQLGIEVFGLGFVTSITFIFVVGVFMSSWLGASVLGLGEWFIKRMPLVRHIYNASKQISAAISPDQNTQAFKEVAIIRHPRIGEYAFGFITSSVVLQNYSGDEELCCVYVPTNHLYIGDIFLVNAKDVIRPNLSVREGIEIVVSGGMSMPQTLQTIDSGIIPGNISRHNRS*
• ORF Type: complete

Annotations of Ll_transcript_353132

• Blastp: Protein LIKE COV 1 from Arabidopsis with 80.57% of identity
• Blastx: Protein CONTINUOUS VASCULAR RING 1 from Arabidopsis with 80.86% of identity
• Eggnog: conserved protein(COG2928)
• Kegg: Link to kegg annotations (AT2G20130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458476.1)
• Pfam: Protein of unknown function (DUF502) (PF04367.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;