Protein coding transcript 73010

• Transcript: Ll_transcript_353135
• CDS coordinates: 3-443 (+)
• Peptide sequence: QFRFVRDTKQTLLQKRTSNNSFALRTPKRRRFMADEKSQIIMATRDRDRELLVPVADSAGDGSATFSKSSSSSSLSHHSGNETFIKVVRSWASKKFMTGCVILFPIAITFYITWWFIHFVDGFFSPIYAQLGIEVFGECFYFMVDW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_353135

• Blastp: Protein CONTINUOUS VASCULAR RING 1 from Arabidopsis with 71.3% of identity
• Blastx: Protein CONTINUOUS VASCULAR RING 1 from Arabidopsis with 64.52% of identity
• Eggnog: conserved protein(COG2928)
• Kegg: Link to kegg annotations (AT2G20120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458476.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;