Protein coding transcript 73028

• Transcript: Ll_transcript_354429
• CDS coordinates: 45-638 (+)
• Peptide sequence: MFDWNRRVNVVKGVANALYHLHHGCSPPIVHRDISSKNVILDLEYEAHVSDFGTAKILNPDSQNFTLFAGTYGYAAPEFAYTMEVDEKCDVFSFGVLSLEIVMGRHPGDLISSLFSSSTTSRASSLLLKDVLDRRLPHPVMPIVKEVILIAKVTFACLSQSPLSRPSMEHVYGEFVMPRSPIVDSFPIVTLGELIYN*
• ORF Type: complete

Annotations of Ll_transcript_354429

• Blastp: MDIS1-interacting receptor like kinase 2 from Arabidopsis with 56.08% of identity
• Blastx: MDIS1-interacting receptor like kinase 2 from Arabidopsis with 53.97% of identity
• Eggnog: leucine Rich Repeat(COG4886)
• Kegg: Link to kegg annotations (AT4G08850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460985.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;