Protein coding transcript 73100

• Transcript: Ll_transcript_354971
• CDS coordinates: 95-406 (+)
• Peptide sequence: MQKNYTHNALRRYAIGGYNGEKMVSTVEVFDPRLDSWMTGESMNTSRGYFSAVVTGNSIFAIGGVNDTGVVLDTVERYDEAHGWQPTCLKAIGKRCKFSAVPL*
• ORF Type: complete

Annotations of Ll_transcript_354971

• Blastp: Kelch-like protein 8 from Mus with 42.47% of identity
• Blastx: Kelch-like protein 8 from Homo with 41.1% of identity
• Eggnog: kelch-like(ENOG410XNX8)
• Kegg: Link to kegg annotations (246293)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437575.1)
• Pfam: Kelch motif (PF01344.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;