Transcript | Ll_transcript_354993 |
---|---|
CDS coordinates | 2-334 (+) |
Peptide sequence | MIGMESSGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSSMKIKVVAPPERKYSVWIGGSILASLSTFQQMWIAKAEYDEAGPSIVHRKCF* |
ORF Type | complete |
Blastp | Actin from Pinus with 93.64% of identity |
---|---|
Blastx | Actin from Pinus with 93.64% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | gga-mir-3533 (MI0015386) |
Ncbi protein | Link to NCBI protein (XP_003539675.1) |
Pfam | Actin (PF00022.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer