Transcript | Ll_transcript_354231 |
---|---|
CDS coordinates | 2533-3312 (+) |
Peptide sequence | MSFGIGKSLQLLRVLNLRGNYLREDDAESLVYAMAHMPILEDLDISDNFIGDEGIRNLIPLFDGTSGMCSHLVCLKVETCELSYVGVGHLLDALSNFKGPLKSLSVADNYLGSQVAEALAKFLSTPIEVLDIAGIGLGSSGFQELQNVVKDDLKLVKIDMSKNRGGIETAKFLSTLLPKAPQLVDVNAASNLMPIESLDIISCALKLAKGNVEHLDLSGHTWNYKPEHASLHTEFVNDGKPILILPSPSLFAAPYDDDP* |
ORF Type | complete |
Blastp | Tonsoku-like protein from Mus with 27.53% of identity |
---|---|
Blastx | NLR family CARD domain-containing protein 3 from Homo with 25.44% of identity |
Eggnog | Ankyrin Repeat(COG0666) |
Kegg | Link to kegg annotations (72749) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456999.1) |
Pfam | Leucine Rich repeat (PF13516.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer