Protein coding transcript 7318

• Transcript: Ll_transcript_395520
• CDS coordinates: 334-843 (+)
• Peptide sequence: MLLSTKKSTPVIWRVLSGLYHKRLTFSDAEVHDVSDPKVKKLGVDALPAIVGWTHNGKKHILKTGISVKDIKSAVSDLSNVLDNFEKTSKKEASNQAKKEQTDSDDEPIQLLSHSNFEVLCGQKTPVCIIGAFRSSKAREKLDSILSVVSASFICNSLKRMLFLSIVLV*
• ORF Type: complete

Annotations of Ll_transcript_395520

• Blastp: DnaJ protein ERDJ3A from Arabidopsis with 59.33% of identity
• Blastx: DnaJ protein ERDJ3A from Arabidopsis with 57.02% of identity
• Eggnog: DNAj domain protein(COG2214)
• Kegg: Link to kegg annotations (AT3G08970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450343.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;