Transcript | Ll_transcript_405084 |
---|---|
CDS coordinates | 103-645 (+) |
Peptide sequence | MANRTDPAAKSIRGTNPQNLVEKILRSKIYQNTYWKEQCFGLTAETLVDKAMELDHLGGTYGGNRKPTPFMCLVMKMLQIQPEKEIVIEFIKNEDYKYVRILGAFYLRLTGSDIDVYRYLEPLYNDYRKLRQKLADGQFSLTHVDEVIDELLTKDYSCDIAMPRIKKRFCSVLIHILWFA* |
ORF Type | complete |
Blastp | Pre-mRNA-splicing factor 38 from Arabidopsis with 87.06% of identity |
---|---|
Blastx | Pre-mRNA-splicing factor 38 from Arabidopsis with 87.06% of identity |
Eggnog | RNA splicing(ENOG410XQ3F) |
Kegg | Link to kegg annotations (AT2G40650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003556528.1) |
Pfam | PRP38 family (PF03371.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer