Protein coding transcript 73293

• Transcript: Ll_transcript_405326
• CDS coordinates: 1930-2718 (+)
• Peptide sequence: MDYAFEFIVNNGGIDSESDYPYKGVDGTCDQYRKNSKVVVIDEYEDVPAYDEKALQKAVANQPVANAVEGGGREFQLYESGIFTGKCGTALDHGVNTVGYGTENGKDYWIVRNSWGPSWGEDGYIRFERNLASSKSGKCGIAIEPSYPVKKGLNPPKPAPSPPTPVQPPSVCDNYYTCAESTTCCCIFEFGNSCFEWGCCPLDGATCCDDHTSCCPHDYPICNVYAGTCLRSANNPFGVKALKRTPALRRSSVGVENKISSA*
• ORF Type: complete

Annotations of Ll_transcript_405326

• Blastp: Oryzain alpha chain from Oryza sativa with 73.68% of identity
• Blastx: Cysteine proteinase RD21A from Arabidopsis with 72.61% of identity
• Eggnog: cathepsin(COG4870)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447132.1)
• Pfam: Papain family cysteine protease (PF00112.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;