Transcript | Ll_transcript_405319 |
---|---|
CDS coordinates | 362-1150 (+) |
Peptide sequence | MDYGFEFIINNGGIDSDEDYPYKAVDGTCDQYRKTAKVVTIDDYEDVPSYDEKALQKAVANQPVAVAIEGGGREFQLYDSGVFTGRCGTALDHGVNAVGYGTENGKDYWIVRNSWGPNWGEDGYIRLERNLASSRSGKCGIAIEPSYPVKAGQNPPKPGPSPPTPVKPPSVCDNYYTCPESTTCCCIYVYANTCFEWGCCPLEGATCCEDHYSCCPHEYPICNIYAGTCLRSMNNPFGVKALKRTPALRRNSAGDENKITSA* |
ORF Type | complete |
Blastp | Cysteine proteinase RD21A from Arabidopsis with 73.15% of identity |
---|---|
Blastx | Cysteine proteinase RD21A from Arabidopsis with 75.91% of identity |
Eggnog | cathepsin(COG4870) |
Kegg | Link to kegg annotations (AT1G47128) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429831.1) |
Pfam | Papain family cysteine protease (PF00112.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer