Transcript | Ll_transcript_405383 |
---|---|
CDS coordinates | 191-748 (+) |
Peptide sequence | MAQNHNNALILDQLRNGTAKFELLSSPVSAPNRFLGVGNCSNLFFARIGSSLGGQSPAMKKLERFSVQKVTGDGRCMFRALVKGMAYNKGTTLNQREERENADELRMAVKEVICENDRERNLYEEALIAITVDEPLRRYCQRIGRPDFWGGESELLVLSKLCKQPVIVYIPEHEMHALCYAYLTD* |
ORF Type | complete |
Blastp | OTU domain-containing protein At3g57810 from Arabidopsis with 30.28% of identity |
---|---|
Blastx | OTU domain-containing protein At3g57810 from Arabidopsis with 30.28% of identity |
Eggnog | otu domain-containing protein(COG5539) |
Kegg | Link to kegg annotations (AT3G57810) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434226.1) |
Pfam | OTU-like cysteine protease (PF02338.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer