Protein coding transcript 73308

• Transcript: Ll_transcript_405384
• CDS coordinates: 191-856 (+)
• Peptide sequence: MAQNHNNALILDQLRNGTAKFELLSSPVSAPNRFLGVGNCSNLFFARIGSSLGGQSPAMKKLERFSVQKVTGDGRCMFRALVKGMAYNKGTTLNQREERENADELRMAVKEVICENDRERNLYEEALIAITVDEPLRRYCQRIGRPDFWGGESELLVLSKLCKQPVIVYIPEHEHRGSGWGSGFIPIAEYGSEFGKVSRNMKPRKPVRLLYSGRNHYDLLI*
• ORF Type: complete

Annotations of Ll_transcript_405384

• Blastp: OTU domain-containing protein At3g57810 from Arabidopsis with 32.91% of identity
• Blastx: OTU domain-containing protein At3g57810 from Arabidopsis with 32.91% of identity
• Eggnog: otu domain-containing protein(COG5539)
• Kegg: Link to kegg annotations (AT3G57810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434226.1)
• Pfam: OTU-like cysteine protease (PF02338.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;