Transcript | Ll_transcript_406904 |
---|---|
CDS coordinates | 35-868 (+) |
Peptide sequence | MLGNDSLIVIFLVYSLSLFHCNIYLFSTSNWRCAETLGDYLAERNIMGIYDVDTRAITRRLRQDGSLVGVLSTDNSKSDGELLQMSRSWDIVGIDLISGVSCKSPHEWVDKTKQDWEFNSKGPGEIFHIVAYDFGIKHNILRRLASYGCKITVVPSTWPASETLKLNPDGVLFSNGPGDPSAVPYAVETVKNILGKVPVFGICMGHQLLGQALGGKTFKMKFGHHGGNHPVRNLRTGHVEISAQVCDGMNFFTFFCTDYVKCMSLKKDCLALSFILP* |
ORF Type | complete |
Blastp | Carbamoyl-phosphate synthase small chain, chloroplastic from Arabidopsis with 80% of identity |
---|---|
Blastx | Carbamoyl-phosphate synthase small chain, chloroplastic from Arabidopsis with 80% of identity |
Eggnog | carbamoyl-phosphate synthetase glutamine chain(COG0505) |
Kegg | Link to kegg annotations (AT3G27740) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462674.1) |
Pfam | Carbamoyl-phosphate synthase small chain, CPSase domain (PF00988.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer