Protein coding transcript 73343

• Transcript: Ll_transcript_406904
• CDS coordinates: 35-868 (+)
• Peptide sequence: MLGNDSLIVIFLVYSLSLFHCNIYLFSTSNWRCAETLGDYLAERNIMGIYDVDTRAITRRLRQDGSLVGVLSTDNSKSDGELLQMSRSWDIVGIDLISGVSCKSPHEWVDKTKQDWEFNSKGPGEIFHIVAYDFGIKHNILRRLASYGCKITVVPSTWPASETLKLNPDGVLFSNGPGDPSAVPYAVETVKNILGKVPVFGICMGHQLLGQALGGKTFKMKFGHHGGNHPVRNLRTGHVEISAQVCDGMNFFTFFCTDYVKCMSLKKDCLALSFILP*
• ORF Type: complete

Annotations of Ll_transcript_406904

• Blastp: Carbamoyl-phosphate synthase small chain, chloroplastic from Arabidopsis with 80% of identity
• Blastx: Carbamoyl-phosphate synthase small chain, chloroplastic from Arabidopsis with 80% of identity
• Eggnog: carbamoyl-phosphate synthetase glutamine chain(COG0505)
• Kegg: Link to kegg annotations (AT3G27740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462674.1)
• Pfam: Carbamoyl-phosphate synthase small chain, CPSase domain (PF00988.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;