Transcript | Ll_transcript_406302 |
---|---|
CDS coordinates | 2071-2625 (+) |
Peptide sequence | MLGKKVLDRGGNVEEPKPWRFAESSSLIEFDTYRASERFPCPPLSNIPEIAQETIGAYEIVRKGVTRLMKKYTVKACGYCSEVHVGPWGHNVKLCGSFKHQWRDGKHGWQDATVREVFPPNHVWHVRDPSGPPLRNKLKTFYGKAPAVIEVCMQAGAQIIPDVYKPMMRLDIVIPDSEEARMIA* |
ORF Type | complete |
Blastp | APO protein 1, chloroplastic from Arabidopsis with 66.13% of identity |
---|---|
Blastx | APO protein 1, chloroplastic from Arabidopsis with 67.02% of identity |
Eggnog | APO protein(ENOG410XP6U) |
Kegg | Link to kegg annotations (AT1G64810) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019414110.1) |
Pfam | APO RNA-binding (PF05634.10) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer