Transcript | Ll_transcript_407686 |
---|---|
CDS coordinates | 1-522 (+) |
Peptide sequence | QGHKEWVTEVNVLGIVEHPNLVKLVGYCADDDERGIQRLLIYEYMPNRSVEHHLSLRTDTHLSWSMRLKIAQDAARGLTYLHEEMDFQIIFRDFKSSNILLDEHWNAKLSDFGLARLGPSEGLSHVSTEVVGTMGYAAPDYFQTGHLTSKSDVWSYGVFLYELITGRRPIDRNR |
ORF Type | internal |
Blastp | Probable serine/threonine-protein kinase PBL19 from Arabidopsis with 62.07% of identity |
---|---|
Blastx | Probable serine/threonine-protein kinase PBL19 from Arabidopsis with 62.07% of identity |
Eggnog | Serine Threonine protein kinase(COG0515) |
Kegg | Link to kegg annotations (AT5G47070) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430643.1) |
Pfam | Protein tyrosine kinase (PF07714.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer