Protein coding transcript 73456

• Transcript: Ll_transcript_405991
• CDS coordinates: 113-1108 (+)
• Peptide sequence: MDESKNLLKLQCSVMNYDWGLKGCDSNVARLFSLNSRSEIDLHKPYAEFWMGTHDSGPSFLHDSSQSLTLKSWISQNPHVLGHNVLHKWGSDLPFLFKVLSVGKALSIQAHPDKELARTLHKLRPGLYKDGSHKPEMALAMTQFEALCGFITLKELKAVLHTVPEVSELIGAENANLVLQTSDQDSEEKLKSVLKAVFTLLMSANKDRITDAVNTLKCRLHKESEMRQLTDKEQLVLQLEKQYPADVGVIAAFFLNLVKLNPGEALFLGPNEPHAYLSGECVECMATSDNVVRAGLTPKHIDVQTLCSMLTYNQVNDTSYIKVVTVVRIGR*
• ORF Type: complete

Annotations of Ll_transcript_405991

• Blastp: Mannose-6-phosphate isomerase 1 from Arabidopsis with 66.01% of identity
• Blastx: Mannose-6-phosphate isomerase 1 from Arabidopsis with 62.39% of identity
• Eggnog: mannose-6-phosphate isomerase(COG1482)
• Kegg: Link to kegg annotations (AT3G02570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418903.1)
• Pfam: Phosphomannose isomerase type I (PF01238.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;