Transcript | Ll_transcript_407739 |
---|---|
CDS coordinates | 249-632 (+) |
Peptide sequence | MALEIAGFEVVQGPVENDAERVKSVLHEKDNGKLEQAQGVGEPIIFGSHGDESAKGDVKEASDATVPKDAVEEWPAPKQIHSFYFVRCRPYDDPNIKSKIDQIDKEMNKKSQARFQVTEALKAKRVS* |
ORF Type | complete |
Blastp | Proton pump-interactor 1 from Arabidopsis with 42.75% of identity |
---|---|
Blastx | Proton pump-interactor 1 from Arabidopsis with 42.75% of identity |
Eggnog | proton pump interactor(ENOG4111QP9) |
Kegg | Link to kegg annotations (AT4G27500) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425813.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer