Transcript | Ll_transcript_406694 |
---|---|
CDS coordinates | 1079-1462 (+) |
Peptide sequence | MLPSEEAFAAAVSALGIQNKDDLVVYDGKGLFSAARVWWMFRVFGHDRVWVLDGGLPRWRASGYDVESSASSDAILKASAATEAIEKTYQGLSVGPITFQTKFQPHLVWNLDQVHCNFYYCHFKCKV* |
ORF Type | complete |
Blastp | Thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial from Arabidopsis with 78.29% of identity |
---|---|
Blastx | Thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial from Arabidopsis with 84.3% of identity |
Eggnog | sulfurtransferase(COG2897) |
Kegg | Link to kegg annotations (AT1G79230) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455759.1) |
Pfam | Rhodanese-like domain (PF00581.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer