Protein coding transcript 73594

• Transcript: Ll_transcript_406669
• CDS coordinates: 206-751 (+)
• Peptide sequence: MASTIFTKTQLGHRFVHSFSSLTLKPHFFSSFFNKQLFCTRAVPAYTAQNTKRTCWAPHMASSVVGARATYSTKSASTNEPVVSVDWLYENLKYPDIKVLDASWYMPDDQRNPIQEYQVAHIPGALFFDVDGISDRSTNLPHMLPSEEAFAAAVSALGIQNKDDLVVYDGKGIFSAARVWW*
• ORF Type: complete

Annotations of Ll_transcript_406669

• Blastp: Thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial from Arabidopsis with 60.96% of identity
• Blastx: Thiosulfate/3-mercaptopyruvate sulfurtransferase 1, mitochondrial from Arabidopsis with 80.27% of identity
• Eggnog: sulfurtransferase(COG2897)
• Kegg: Link to kegg annotations (AT1G79230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455759.1)
• Pfam: Rhodanese-like domain (PF00581.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;