Protein coding transcript 73650

• Transcript: Ll_transcript_407321
• CDS coordinates: 291-929 (+)
• Peptide sequence: MITGNRSGGRTPLNWESRVKISLGTARGIAHIHSVCGPKFTHGNIKSANVLLNQENDGCISDFGLTPLMNVPATPFRAAGYRAPEVIELRKHTHKSDVYSFGVLLLEMLTGKSPIQSPGHDDIVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIAMACVAKMPDMRPSMDDVVKMIDDIRQFDSENGPSTEENKSKDSNVLTP*
• ORF Type: complete

Annotations of Ll_transcript_407321

• Blastp: Probable inactive receptor kinase At5g58300 from Arabidopsis with 72.99% of identity
• Blastx: Probable inactive receptor kinase At5g58300 from Arabidopsis with 72.51% of identity
• Eggnog: inactive receptor kinase(ENOG4111F0S)
• Kegg: Link to kegg annotations (AT5G58300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419789.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;