Protein coding transcript 73653

• Transcript: Ll_transcript_407326
• CDS coordinates: 412-846 (+)
• Peptide sequence: MNVPATPSRTAGYRAPEVIETRKHTHKSDVYSFGVLLLEMLTGKAPIQSPGRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMACVAKMPDMRPSMDEVVKMIEEIRQSDSENRPSSEENKSKDSNVQTP*
• ORF Type: complete

Annotations of Ll_transcript_407326

• Blastp: Probable inactive receptor kinase At5g58300 from Arabidopsis with 80.56% of identity
• Blastx: Probable inactive receptor kinase At5g58300 from Arabidopsis with 76.06% of identity
• Eggnog: inactive receptor kinase(ENOG4111F0S)
• Kegg: Link to kegg annotations (AT5G58300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439586.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;