Protein coding transcript 73673

• Transcript: Ll_transcript_405979
• CDS coordinates: 225-866 (+)
• Peptide sequence: MDKEEGGFKIMGRIEIDTSAPFKSVKEAVMLFGERVLVGEIYANKLNEMRVIASETGNAQSRVRALENELEETKQKLEKAIEESNFMAQYVKSLKKELEQTKKELEDTKVRETILLKRRGDDAEIESLKFNENSTNVEMKRTQSDDEAIEYQKRRYVKFASPHALAQVIPNKEEMLERPPSVNNKGKKKQLVPLIGRLFSKKKGSHEVEYPIA*
• ORF Type: complete

Annotations of Ll_transcript_405979

• Blastp: WEB family protein At2g17940 from Arabidopsis with 36.99% of identity
• Blastx: WEB family protein At2g17940 from Arabidopsis with 37.16% of identity
• Eggnog: NA(ENOG410YQJI)
• Kegg: Link to kegg annotations (AT2G17940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420513.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;