Protein coding transcript 73674

• Transcript: Ll_transcript_405981
• CDS coordinates: 736-1242 (+)
• Peptide sequence: MIKMRVIASETGNAQSRVRALENELEETKQKLEKAIEESNFMAQYVKSLKKELEQTKKELEDTKVRETILLKRRGDDAEIESLKFNENSTNVEMKRTQSDDEAIEYQKRRYVKFASPHALAQVIPNKEEMLERPPSVNNKGKKKQLVPLIGRLFSKKKGSHEVEYPIA*
• ORF Type: complete

Annotations of Ll_transcript_405981

• Blastp: WEB family protein At3g51220 from Arabidopsis with 35.67% of identity
• Blastx: WEB family protein At1g75720 from Arabidopsis with 67.65% of identity
• Eggnog: NA(ENOG410YQJI)
• Kegg: Link to kegg annotations (AT3G51220)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420513.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;