Protein coding transcript 73714

• Transcript: Ll_transcript_407273
• CDS coordinates: 1035-1727 (+)
• Peptide sequence: MGIDLKFFFVRAGMMGWLLINLSVIAKSIEAGTLDTSMILYQIFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLKNKVELTTAAIVANCFVFLIGYKVFRGANKQKHDFKKNPKAPIWGKPPKVIGGKLLASGYWGVARHCNYLGDLMLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEARCAEKYKEIWAQYRKLVPWRILPYVY*
• ORF Type: complete

Annotations of Ll_transcript_407273

• Blastp: Delta(14)-sterol reductase from Arabidopsis with 88.7% of identity
• Blastx: Delta(14)-sterol reductase from Arabidopsis with 84.05% of identity
• Eggnog: )-reductase(ENOG410XP67)
• Kegg: Link to kegg annotations (AT3G52940)
• CantataDB: Link to cantataDB annotations (CNT0002437)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428896.1)
• Pfam: Ergosterol biosynthesis ERG4/ERG24 family (PF01222.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;