Protein coding transcript 7372

• Transcript: Ll_transcript_395629
• CDS coordinates: 279-1070 (+)
• Peptide sequence: MDEFWTPFFIPTTNPRTTIATTTASHISHSQQNMDHPQNVLFSDHTEPPHFSPITPSPPMLYAPPPFIAPYDQNLGAPFMHMNQPSLGGYPMYSVPVQHSNVTIPTYEPRGLIQSREENMQMNEALMAKIARYRRKQARQRVRSNSSTLGLPSIPEGTIRGQPQVTHVFYAPNGKMLTQFLTKKLRNSDVGNVGRIIIPKRGAEEMLPTLCKKEGTNVILQDVYSDLKWSFKYKYWSNNKSHRMYVLENTGKTSLFVSIKLSL*
• ORF Type: complete

Annotations of Ll_transcript_395629

• Blastp: B3 domain-containing transcription factor LEC2 from Arabidopsis with 60% of identity
• Blastx: B3 domain-containing transcription factor LEC2 from Arabidopsis with 60% of identity
• Eggnog: leafy cotyledon 2(ENOG41116MG)
• Kegg: Link to kegg annotations (AT1G28300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420894.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;