Protein coding transcript 74084

• Transcript: Ll_transcript_405549
• CDS coordinates: 728-1111 (+)
• Peptide sequence: MCPCSYGYDPFGLGKKPEDFAKYQANELIQGRWAMLGAAGFIIPEAFNKYGANCGPEAVWFKTGAQLLDGNTLNYFGKPIPINLVVTVIAEIVLLGGAEYYRITNGLDLEDKLHPGGPFDPLGLAKDP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_405549

• Blastp: Chlorophyll a-b binding protein CP26, chloroplastic from Arabidopsis with 57.73% of identity
• Blastx: Chlorophyll a-b binding protein CP26, chloroplastic from Arabidopsis with 90.24% of identity
• Eggnog: Chlorophyll A-B binding protein(ENOG41110WY)
• Kegg: Link to kegg annotations (AT4G10340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017440449.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;